1point02.jp
1.67 Rating by hostinfo.pw
Traffic Report
| Daily Unique Visitors: | 6,599 |
| Daily Pageviews: | 26,396 |
Estimated Valuation
| Income Per Day: | No data |
| Estimated Worth: | No data |
Search Engine Indexes
| Google Indexed Pages: | No data |
| Yahoo Indexed Pages: | No data |
| Bing Indexed Pages: | No data |
Search Engine Backlinks
| Google Backlinks: | No data |
| Bing Backlinks: | No data |
| Alexa BackLinks: | No data |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | No data |
| WOT Trustworthiness: |
 No data
|
| WOT Privacy: |
No data
|
| WOT Child Safety: |
No data
|
Website Inpage Analysis
| Total IFRAMEs: | No data |
| Total Images: | 11 |
| Google Adsense: | pub-3504680814265993 |
| Google Analytics: | UA-67017530-1 |
Website Ranks & Scores
| Alexa Rank: | 206,079 |
| PageSpeed Score: | 58 out of 100 |
| Domain Authority: | No data |
Web Server Information
Location Latitude:
35.6895Location Longitude:
139.692HTTP Header Analysis
Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Server: Microsoft-IIS/8.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Wed, 05 Jun 2019 03:30:07 GMT
Content-Length: 77472
Status-Code: 200
Status: 200 OK
Cache-Control: private
Content-Type: text/html; charset=utf-8
Server: Microsoft-IIS/8.5
X-AspNet-Version: 4.0.30319
X-Powered-By: ASP.NET
Date: Wed, 05 Jun 2019 03:30:07 GMT
Content-Length: 77472
Domain Information
| Domain Registrar: | Japan Registry Services |
|---|---|
| Registration Date: | 2015-07-20 |
| Last Modified: | 2018-08-01 |
| Expiration Date: | 2019-07-31 |
| Owner's E-Mail: | 1point02@deltagraphs.co.jp |
Domain Nameserver Information
| Host | IP Address | Country | |
|---|---|---|---|
| ns1.do-reg.jp | 203.183.220.201 |  Japan |
|
| ns2.do-reg.jp | 164.46.1.117 | Japan |
|
DNS Record Analysis
| Type | TTL | Extra |
|---|---|---|
| A | 154 |
IP: 54.65.149.125 |
| NS | 154 |
Target: NS1.DO-REG.jp |
| NS | 154 |
Target: NS2.DO-REG.jp |
| SOA | 180 |
MNAME: NS1.DO-REG.jp RNAME: root.1point02.jp Serial: 1601160129 Refresh: 10800 Retry: 3600 Expire: 360000 |
| MX | 180 |
Priority: 10 Target: MAIL.1point02.jp |
Full WHOIS Lookup
[ JPRS database provides information on network administration. Its use is ]
[ restricted to network administration purposes. For further information, ]
[ use 'whois -h whois.jprs.jp help'. To suppress Japanese output, add'/e' ]
[ at the end of command, e.g. 'whois -h whois.jprs.jp xxx/e'. ]
Domain Information:
[Domain Name] 1POINT02.JP
[Registrant] DELTA, Inc.
[Name Server] ns1.do-reg.jp
[Name Server] ns2.do-reg.jp
[Signing Key]
[Created on] 2015/07/20
[Expires on] 2019/07/31
[Status] Active
[Last Updated] 2018/08/01
01:05:09 (JST)
Contact Information:
[Name] Do-reg Whois Guard Service,Firstserver Inc.
[Email] 1point02@deltagraphs.co.jp
[Web Page]
[Postal code] 160-0004
[Postal Address] 4-29 Yotsuya, Shinjuku-ku,
Tokyo 160-0004, JAPAN
[Phone] 03-5919-8283
[Fax] 03-5919-8311
[ restricted to network administration purposes. For further information, ]
[ use 'whois -h whois.jprs.jp help'. To suppress Japanese output, add'/e' ]
[ at the end of command, e.g. 'whois -h whois.jprs.jp xxx/e'. ]
Domain Information:
[Domain Name] 1POINT02.JP
[Registrant] DELTA, Inc.
[Name Server] ns1.do-reg.jp
[Name Server] ns2.do-reg.jp
[Signing Key]
[Created on] 2015/07/20
[Expires on] 2019/07/31
[Status] Active
[Last Updated] 2018/08/01
01:05:09 (JST)
Contact Information:
[Name] Do-reg Whois Guard Service,Firstserver Inc.
[Email] 1point02@deltagraphs.co.jp
[Web Page]
[Postal code] 160-0004
[Postal Address] 4-29 Yotsuya, Shinjuku-ku,
Tokyo 160-0004, JAPAN
[Phone] 03-5919-8283
[Fax] 03-5919-8311
Similarly Ranked Websites
actividadesdeinfantilyprimaria.com
Recursos para trabajar en infantil y primaria
206,083 
$ 39,960.00
xn----gtbdmbeft1bdk.net
Развивающие материалы для детей всех возрастов. Прописи, раскраски, стенгазеты, загадки, лабиринты, стихи, сказки, поделки и множество других разнообразных материалов.
206,084 $ 39,960.00
legoland.dk
LEGOLAND® Billund Resort er Danmarks mest kendte og elskede forlystelsespark blandt børnefamilier og børn i alle aldre. Her er masser af action, fart og sjov.
206,085 $ 39,960.00
sanamelk.com
جهت خرید باغ و باغچه,باغ ویلا,کارخانه و سوله در شهریار,ملارد,محمدشهر,زیبادشت,کردزار,اطراف تهران به صناملک مراجعه کنید.
206,086 $ 39,960.00
happybirthdaywishesworld.com
A world of birthday wishes for you to choose from. Find the perfect birthday wish for your family member or friend.
206,086 $ 39,960.00